PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Itr_sc000828.1_g00002.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Convolvulaceae; Ipomoeeae; Ipomoea
Family NAC
Protein Properties Length: 322aa    MW: 35746.3 Da    PI: 7.6868
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Itr_sc000828.1_g00002.1genomeKazusaView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM168.22.8e-52141391128
                      NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkat 86 
                              lppGfrF Ptdeel+v+yL+kkv+g++++l ++i e+d+yk++Pw Lp+k++ +ekewyfFs+rd+ky++g+r+nr++ sgyWkat
  Itr_sc000828.1_g00002.1  14 LPPGFRFYPTDEELLVQYLCKKVAGHDFSL-RIIGEIDLYKFDPWVLPSKATFGEKEWYFFSPRDRKYPNGSRPNRVAGSGYWKAT 98 
                              79***************************9.89***************988899******************************** PP

                      NAM  87 gkdkevlskkgelvglkktLvfykgrapkgektdWvmheyrl 128
                              g+dk +++ +g++vg+kk Lvfy g+apkg+kt+W+mheyrl
  Itr_sc000828.1_g00002.1  99 GTDKVITT-EGRKVGIKKALVFYVGKAPKGSKTNWIMHEYRL 139
                              ******99.999****************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019411.57E-6510162IPR003441NAC domain
PROSITE profilePS5100560.30514162IPR003441NAC domain
PfamPF023653.1E-2615139IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 322 aa     Download sequence    Send to blast
MGVKETDPLS QLSLPPGFRF YPTDEELLVQ YLCKKVAGHD FSLRIIGEID LYKFDPWVLP  60
SKATFGEKEW YFFSPRDRKY PNGSRPNRVA GSGYWKATGT DKVITTEGRK VGIKKALVFY  120
VGKAPKGSKT NWIMHEYRLS DAPKKTGSSR LDEWVLCRIY KKHSSAEKAI SGGVPTKEHS  180
HGSPSSTSSQ FDDMLVALPE LNDQSFVLPA MNNLKQEEQV DLHELGPMSF DWNTISAAQP  240
TLPDFSAGAG AGNQVSAVQV TGNGVNYQND VFAHAMAMNF QAPDDEVQSG LRSFFLPQSF  300
SNSPDPFGIR YPTQSPSMGF RP
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ut4_A1e-10711684171NO APICAL MERISTEM PROTEIN
1ut4_B1e-10711684171NO APICAL MERISTEM PROTEIN
1ut7_A1e-10711684171NO APICAL MERISTEM PROTEIN
1ut7_B1e-10711684171NO APICAL MERISTEM PROTEIN
3swm_A1e-10711687174NAC domain-containing protein 19
3swm_B1e-10711687174NAC domain-containing protein 19
3swm_C1e-10711687174NAC domain-containing protein 19
3swm_D1e-10711687174NAC domain-containing protein 19
3swp_A1e-10711687174NAC domain-containing protein 19
3swp_B1e-10711687174NAC domain-containing protein 19
3swp_C1e-10711687174NAC domain-containing protein 19
3swp_D1e-10711687174NAC domain-containing protein 19
4dul_A1e-10711684171NAC domain-containing protein 19
4dul_B1e-10711684171NAC domain-containing protein 19
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009594219.11e-148PREDICTED: NAC domain-containing protein 72
RefseqXP_016484889.11e-148PREDICTED: NAC domain-containing protein 72-like
SwissprotQ93VY31e-115NAC72_ARATH; NAC domain-containing protein 72
TrEMBLE0CSQ11e-141E0CSQ1_VITVI; Putative uncharacterized protein
STRINGVIT_19s0014g03290.t011e-140(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA31222452
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G27410.21e-114NAC family protein